@jenstilmanydots Avatar @jenstilmanydots JennyManyDots

JennyManyDots posts on X about china, canada, silver, financial the most. They currently have [------] followers and [---] posts still getting attention that total [------] engagements in the last [--] hours.

Engagements: [------] #

Engagements Line Chart

Mentions: [--] #

Mentions Line Chart

Followers: [------] #

Followers Line Chart

CreatorRank: [-------] #

CreatorRank Line Chart

Social Influence

Social category influence finance 25.49% countries 23.53% stocks 5.88% currencies 2.94% cryptocurrencies 1.96% technology brands 1.96% social networks 0.98% travel destinations 0.98%

Social topic influence china #3899, canada #3438, silver 5.88%, financial #928, trade #1636, this is 4.9%, gold 3.92%, more than 3.92%, in the 3.92%, currencies #40

Top accounts mentioned or mentioned by @paulwar76911334 @jameskwantes @kymeleon1 @allanbreports @santiagoaufund @v12farmcat @jj04519737 @albertagarbage @dinkanata @alfredenewman5 @chriscollins888 @mcgiltonchris @stanulch @ivanbebek71 @securedataacces @jaymartinbc @newsfilepacificasilvermakesnewhighgradediscoveryatclaudia @freegolds @myrmikan @gemtones

Top assets mentioned Teck Resources Limited (TECK) Cencora, Inc. (COR) Bank of America (BAC) Alphabet Inc Class A (GOOGL)

Top Social Posts

Top posts by engagements in the last [--] hours

"$EMNT.v Eminent Gold has been on my watchlist since last year ✅ Thrilled to see $PSIL.cn attending ✅ Looking fwd to an update from $COPR's @ivanbebek71 too ✅ If y'all have questions for ones on this list please let me know. /END"
X Link 2025-10-28T20:56Z 17.3K followers, [---] engagements

"Can you blame a girl for loving the Lundins @SecureDataAcces ❤💍 @jenstilmanydots Not the L group Id rather get a proposal than a job offer from one of them 😉 @jenstilmanydots Not the L group Id rather get a proposal than a job offer from one of them 😉"
X Link 2025-11-12T19:24Z 17.3K followers, [----] engagements

"Canadian government has approved Anglo American Plcs acquisition of $TECK helping to clear the way for the creation of a $50 billion metals giant focused on #copper mines in Chile and Peru. https://www.bloomberg.com/news/articles/2025-12-16/anglo-and-teck-win-canada-s-approval-to-form-50-billion-miner https://www.bloomberg.com/news/articles/2025-12-16/anglo-and-teck-win-canada-s-approval-to-form-50-billion-miner"
X Link 2025-12-16T13:57Z 17.3K followers, [----] engagements

"My favourites at VRIC 🥰 $FWZ $PSIL $COR"
X Link 2026-01-26T21:55Z 17.3K followers, [----] engagements

"You know I have a lot of Canadian friends. Trudeau recognized China more than a year before Kissingers then-boss Richard Nixon did. Shocking 🙄 https://www.policymagazine.ca/kissinger-on-canada-or-realism-vs-self-righteousness-at-madison-square-garden/ https://www.policymagazine.ca/kissinger-on-canada-or-realism-vs-self-righteousness-at-madison-square-garden/"
X Link 2026-01-30T14:44Z 17.2K followers, [---] engagements

"Alright peeps let's talk Basel Endgame - because if you don't know about it you should. Especially if you own crypto stablecoin gold silver or equities. Here's a quick overview in simple terms and why it matters"
X Link 2026-02-02T14:29Z 17.3K followers, [----] engagements

"US banks tend to use more leverage rely more on short-term funding hold assets that look safe but can move fast (Treasuries mortgages derivatives). Basel treats these as Potentially unstable in a crisis"
X Link 2026-02-02T14:29Z 17.3K followers, [---] engagements

"The Basel Rulebook is global but it will hit the US banking system the hardest because of the way it operates. Basel rules aren't legally binding treaties so in the US they only take effect if regulators jointly propose them (Fed OCC and FDIC)"
X Link 2026-02-02T14:29Z 17.3K followers, [---] engagements

"Amundi is not alone @SantiagoAuFund 🤔 Heavyweights 👇 FSB regional corridors 👇 https://www.fsb.org/about/rcgs/list-of-members-of-the-fsb-regional-consultative-group-for-europe/ https://www.groupgifcs.org/about/history And where will they de-risk In China Or in third countries which are boosting their ties with the US right now https://www.fsb.org/about/rcgs/list-of-members-of-the-fsb-regional-consultative-group-for-europe/ https://www.groupgifcs.org/about/history And where will they de-risk In China Or in third countries which are boosting their ties with the US right now"
X Link 2026-02-06T13:26Z 17.3K followers, [---] engagements

"@v12farmcat Youre nor entirely wrong and I recently told some friends that I made the same error. However there are other very important FACTS the BTC shillers are omitting - the very same people/system they seek to avoid they instead became useful tools for. 👇 https://www.bankofengland.co.uk/speech/2018/mark-carney-speech-to-the-inaugural-scottish-economics-conference https://www.bankofengland.co.uk/speech/2018/mark-carney-speech-to-the-inaugural-scottish-economics-conference"
X Link 2026-02-07T19:18Z 17.2K followers, [--] engagements

"Jay Martin is a gifted author this made me cry - beautifully written and so true. Its all about the people. Glad to hear Gretchen is recovering @JayMartinBC - you were missed. And it was indeed an incredible conference thank you 🙏 https://open.substack.com/pub/jaymartin/p/that-was-the-second-time-i-missedr=1a12j&utm_medium=ios&shareImageVariant=overlay https://open.substack.com/pub/jaymartin/p/that-was-the-second-time-i-missedr=1a12j&utm_medium=ios&shareImageVariant=overlay"
X Link 2026-02-07T20:17Z 17.2K followers, [----] engagements

"Weekend thoughts From the late 1940s through the 1960s #oil prices barely moved in real terms. Gasoline was cheap and #energy costs were not a major political issue. Stability creates confidence and confidence turned into complacency. /1 of 8"
X Link 2026-02-07T21:07Z 17.3K followers, [----] engagements

"The Seven Sisters dominated global production. They operated concessions in the Middle East and elsewhere managed output and smoothed disruptions. To consuming countries this felt like a guarantee of supply"
X Link 2026-02-07T21:07Z 17.3K followers, [---] engagements

"Huge oil fields were found in Iraq Venezuela Saudi Arabia Iran Kuwait. The Middle East in particular was seen as holding near-limitless reserves. The idea that these producers might restrict supply wasnt taken seriously"
X Link 2026-02-07T21:07Z 17.3K followers, [---] engagements

"The 1973-74 oil crisis was so devastating because of how deeply it violated expectations. The idea that oil could be weaponized politically and become suddenly scarce or quadruple in price was outside mainstream thinking"
X Link 2026-02-07T21:07Z 17.2K followers, [---] engagements

"Prior to [----] oil was treated more like an industrial utility than a strategic resource. The crisis forced a complete rethinking of energy geopolitics and economic vulnerability"
X Link 2026-02-07T21:07Z 17.3K followers, [---] engagements

"The lead-up to Pierre Trudeaus National Energy Program (NEP) is basically a straight line from the 1970s oil shocks mixed with Canadian federal-provincial politics and a lot of regional resentment. More details for our subsribers in Sandpipers February edition 👀"
X Link 2026-02-07T21:07Z 17.3K followers, [---] engagements

"Something to think about https://www.berkshirehathaway.com/letters/2006ltr.pdf https://www.berkshirehathaway.com/letters/2006ltr.pdf"
X Link 2026-02-07T22:10Z 17.3K followers, [---] engagements

"@PaulWar76911334 Exactly - there are reasons he bought Chubb and has been selling Bank of America. Reasons he sold Taiwan Semi and bought OXY and Chevron and Sirius XM. All blatantly obvious if viewed through the lens of Basel III and WWIII"
X Link 2026-02-08T13:51Z 17.3K followers, [---] engagements

"@PaulWar76911334 Initially I assumed the same - and though I believe you are correct I think Basel III also was behind it (same Chubb). See his Wells Fargo buy prior to GFC"
X Link 2026-02-08T14:54Z 17.3K followers, [--] engagements

"Key quotes: WSJ Kevin Warsh Nov [----] The Basel endgame isnt Americas endgame. A new reformed American regulatory regime should make the US the best place for the worlds banks to be business. /1 of [--] https://www.wsj.com/opinion/the-federal-reserves-broken-leadership-43629c87 https://www.wsj.com/opinion/the-federal-reserves-broken-leadership-43629c87"
X Link 2026-02-08T22:46Z 17.3K followers, [---] engagements

"Yellen and Powell spent more than a decade negotiating bank regulatory and supervisory standards with their global counterpartsto a complicated vaunted set of rules in the name of global regulatory convergence"
X Link 2026-02-08T22:46Z 17.3K followers, [---] engagements

"@JJ04519737 Seen this Check out the criteria 🤔 https://ised-isde.canada.ca/site/ised/en/enabling-large-scale-sovereign-ai-data-centres https://ised-isde.canada.ca/site/ised/en/enabling-large-scale-sovereign-ai-data-centres"
X Link 2026-02-09T00:48Z 17.3K followers, [--] engagements

"$PSIL.cn Makes New High-Grade Discovery at Claudia with [----] g/t Au and [---] g/t Ag over [----] m from Justina Vein https://ceo.ca/@newsfile/pacifica-silver-makes-new-high-grade-discovery-at-claudia https://ceo.ca/@newsfile/pacifica-silver-makes-new-high-grade-discovery-at-claudia"
X Link 2026-02-09T13:04Z 17.3K followers, [----] engagements

"With up to [--] new mines expected to start by [----] alone Ontario is building for the future by accelerating a critical transmission line that will energize the north and boost the economy said Stephen Lecce Minister of Energy and Mines. https://news.ontario.ca/en/release/1007013/ontario-fast-tracks-barrie-to-sudbury-transmission-line-with-first-nation-partnership https://news.ontario.ca/en/release/1007013/ontario-fast-tracks-barrie-to-sudbury-transmission-line-with-first-nation-partnership"
X Link 2026-02-10T00:14Z 17.3K followers, [----] engagements

"SEPT. [--] [----] https://www.upi.com/Archives/1981/09/19/Prime-Minister-Pierre-Trudeau-and-US-President-Ronald-Reagan/4479369720000/ https://www.upi.com/Archives/1981/09/19/Prime-Minister-Pierre-Trudeau-and-US-President-Ronald-Reagan/4479369720000/"
X Link 2026-02-10T01:25Z 17.3K followers, [---] engagements

"'Compared with prior governments Bill C5 represents a significant expansion of federal discretion and centralized authority over economic projects though it stops short of outright nationalization.' Phew - while as long as it 'stops short' I guess we're okay then. https://laws-lois.justice.gc.ca/eng/AnnualStatutes/2025_2/FullText.html https://laws-lois.justice.gc.ca/eng/AnnualStatutes/2025_2/FullText.html"
X Link 2026-02-10T01:57Z 17.3K followers, [----] engagements

"@freegolds @Myrmikan Remarkably accurate sequence of price movements in commodities prior to conflict. Gold moves first. Oil moves last"
X Link 2026-02-10T07:39Z 17.3K followers, [---] engagements

"I see others are taking notice. 'On January 23rd $PSIL.cn raised $23011500 at $1.45 per share including investments from Vizsla Silver First Majestic Silver Silvercorp Metals and billionaire Eric Sprott.' https://www.inflation.us/news/articles/new-nia-silver-stock-suggestion-pacifica-silver/ https://www.inflation.us/news/articles/new-nia-silver-stock-suggestion-pacifica-silver/"
X Link 2026-02-10T14:25Z 17.3K followers, [----] engagements

"@Gem_Tones @Sorenthek There's a lot more to it IMO. They only refer to Basel III as Basel Endgame in the United States. This is about global governance with China at the helm. https://www.fsb.org/about/rcgs/ https://www.fsb.org/about/rcgs/"
X Link 2026-02-10T16:33Z 17.3K followers, [--] engagements

"Dalio They can tax that way You think your taxes are bad now Just wait because they are going to double. At a minimum. https://www.britacom.org Billionaire hedge fund manager Ray Dalio just told Tucker Carlson that central bank digital currencies are coming: "There will be no privacy. all transactions will be known. and if you're politically disfavored you could be shut off." https://t.co/Jz3mcdvC04 https://www.britacom.org Billionaire hedge fund manager Ray Dalio just told Tucker Carlson that central bank digital currencies are coming: "There will be no privacy. all transactions will be"
X Link 2026-02-11T03:07Z 17.3K followers, [----] engagements

"@tmaxftw @GeorgeGammon Indeed https://www.bankofengland.co.uk/speech/2018/mark-carney-speech-to-the-inaugural-scottish-economics-conference https://www.bankofengland.co.uk/speech/2018/mark-carney-speech-to-the-inaugural-scottish-economics-conference"
X Link 2026-02-11T03:33Z 17.3K followers, [--] engagements

"@Albertagarbage Maybe they are dealing with government officials/law enforcement and are unable to comment or maybe other employees and their families are being threatened if they speak out; no doubt they are struggling with their own grief. Speculating and assuming the worst is unfair"
X Link 2026-02-11T06:19Z 17.3K followers, [---] engagements

"@Kymeleon1 Want to explain the sales in [----] [----] [----] [----] [----] Similar quantities. Because I dont recall kidnapping and murder then"
X Link 2026-02-11T13:50Z 17.3K followers, [---] engagements

"@Kymeleon1 Only to those that cant be bothered to look further back at the history of insider filings. FTR I have not owned VZLA in some time since the El Chapo incident. I hosted a spaces w Mike and another CEO in Sonora to discuss the risk and I disclosed that at the time"
X Link 2026-02-11T14:02Z 17.3K followers, [--] engagements

"RT @allanbreports: @jenstilmanydots Mike is a stand up guy that I have plenty of faith in him doing the right things. Always. And he has a"
X Link 2026-02-11T17:01Z 17.3K followers, [--] engagements

"🔥 Bloc Qubcois MP Simard: Im just not convinced that it is in the public interest to build oil and gas infrastructure Response: With respect Mr. Simard where do you think your Provinces $17 billion per year in transfer payments come from Its funded from this sector. https://t.co/mp6Ofe1Fft Bloc Qubcois MP Simard: Im just not convinced that it is in the public interest to build oil and gas infrastructure Response: With respect Mr. Simard where do you think your Provinces $17 billion per year in transfer payments come from Its funded from this sector. https://t.co/mp6Ofe1Fft"
X Link 2026-02-11T18:17Z 17.3K followers, [----] engagements

"Two things every investor should be keeping up to date on: Basel Endgame and US-China relations. I've gifted this article from Bloomberg but sometimes the links don't work so I've put it in a google doc below ICYI. https://docs.google.com/document/d/10KiPp57PpJTHNNhneANklk5ciabcS7JhLoNKPOn7bEk/editusp=sharing"
X Link 2026-02-11T18:38Z 17.3K followers, [---] engagements

"(Newsflash - Peru is not the only country.👋) Trump admin warns Peru is losing sovereignty over a Chinese-owned port near its capital city after a local judge ruled that the port is exempt from some regulatory oversight. /1 of [--] https://www.bloomberg.com/news/articles/2026-02-11/trump-administration-warns-peru-that-a-chinese-port-is-costing-its-sovereignty https://www.bloomberg.com/news/articles/2026-02-11/trump-administration-warns-peru-that-a-chinese-port-is-costing-its-sovereignty"
X Link 2026-02-11T20:21Z 17.3K followers, [---] engagements

"Let this be a cautionary tale for the region anNewly installed US Ambassador to Peru Bernie Navarro also criticized Peru. Everything has a price. In the long term what was cheap is costly. There is no higher price to pay than losing sovereignty"
X Link 2026-02-11T20:21Z 17.3K followers, [---] engagements

".photo with Peruvian President Jose Jeri eating cheese burgers and calling it a changing the menu in an apparent reference to unreported meetings that the Peruvian president held in Chinese restaurants"
X Link 2026-02-11T20:21Z 17.3K followers, [---] engagements

"RT @spectatorindex: Household debt as share of GDP. Canada: 103% UK: 80% US: 73% France: 63% China: 62% Germany: 52%"
X Link 2026-02-11T20:28Z 17.3K followers, [---] engagements

"RT @PeterSchiff: The biased and clueless mainstream financial media covers Bitcoin's "unexpected" 50% decline as if it's just another great"
X Link 2026-02-11T20:28Z 17.3K followers, [---] engagements

"Going over the US National Security Strategy again - when you know where all of this is coming from the world today makes much more sense. The UN is not an irrelevant institution but rather an evil and highly influential one. https://www.whitehouse.gov/wp-content/uploads/2025/12/2025-National-Security-Strategy.pdf https://www.whitehouse.gov/wp-content/uploads/2025/12/2025-National-Security-Strategy.pdf"
X Link 2026-02-11T20:39Z 17.3K followers, [---] engagements

""Public awareness of these vulnerabilities and civic preparedness is not alarmism. It is responsible civil defence planning." Again - hits differently once you realize what's going on behind the scenes. National Post must-read from Sept. https://docs.google.com/document/d/1UXkHA8EMFbML_8bwJnmDhUi0bCKP85IsQKBOwajsSzc/editusp=sharing https://nationalpost.com/opinion/erin-otoole-when-the-lights-go-out-a-warning-about-cyber-risks https://docs.google.com/document/d/1UXkHA8EMFbML_8bwJnmDhUi0bCKP85IsQKBOwajsSzc/editusp=sharing"
X Link 2026-02-11T21:02Z 17.3K followers, [---] engagements

"RT @MLInstitute: The question is no longer whether this is happening. The question is whether Canada is prepared to respond with the serio"
X Link 2026-02-11T22:30Z 17.3K followers, [---] engagements

"RT @RonStoeferle: Ive noticed a distinct shift in psychology during my speaking engagements. The conversations after my speech have clearl"
X Link 2026-02-12T04:05Z 17.3K followers, [--] engagements

"RT @myabradshaw78: Anyone miss the days when a $16 glass of orange juice forced someone to resignI know I sure do"
X Link 2026-02-12T04:14Z 17.3K followers, [----] engagements

"RT @JrMiningNetwork: ATEX Resources Extends High-Grade Breccia Mineralization by [---] Meters to the North at the B2B Zone $ATX.V https://t.c"
X Link 2026-02-12T12:50Z 17.3K followers, [--] engagements

"THIS 💯 I wrote a lengthy article in my recent newsletter on it. Its already happening people just dont realize it yet. Don't kid yourself. Should there be a global sovereign debt and currency crisis Carney will seize and then nationalize mining and oil and gas assets to backstop its debt and there will be nothing the Provinces will do about it. The Provincial assets are his insurance policy. Now Don't kid yourself. Should there be a global sovereign debt and currency crisis Carney will seize and then nationalize mining and oil and gas assets to backstop its debt and there will be nothing the"
X Link 2026-02-12T13:36Z 17.3K followers, [----] engagements

"Its real. Not like Canadians care enough to read the bills being passed that will radically alter their lives. Because Carney gives good speeches. SMH. https://www.parl.ca/documentviewer/en/45-1/bill/C-5/royal-assent I cant even believe this is real Canada Minister Marc Miller is questioned about their new bill under the Liberal government led by Prime Minister Mark Carney that would EXEMPT ALL MINISTERS FROM ALL LAWS Yes you heard that correctly Hidden in the omnibus budget https://t.co/557aEEwH4K https://www.parl.ca/documentviewer/en/45-1/bill/C-5/royal-assent I cant even believe this is"
X Link 2026-02-12T13:44Z 17.3K followers, [----] engagements

"@SantiagoAuFund As a Canadian I am not laughing. How about instead of the dog you help get me a green card 🙏"
X Link 2026-02-12T13:57Z 17.3K followers, [---] engagements

"@SteveWps Progress and prosperity via the UN. Just not for the electorate. https://www.pm.gc.ca/en/news/news-releases/2024/09/24/prime-minister-advances-progress-and-prosperity-united-nations https://www.pm.gc.ca/en/news/news-releases/2024/09/24/prime-minister-advances-progress-and-prosperity-united-nations"
X Link 2026-02-12T14:13Z 17.3K followers, [----] engagements

"@DinKanata Yup. Honestly its already being done just under the guise of something else. Billions and billions that they claim are creating better living conditions. True ownership is not via the Indigenous. #FollowTheMoney https://www.ictinc.ca/blog/inadequate-housing-3-of-8-key-issues https://www.ictinc.ca/blog/inadequate-housing-3-of-8-key-issues"
X Link 2026-02-12T14:20Z 17.3K followers, [--] engagements

"Economist 2023: How might China change its behaviour if war were on the horizon The answer is that it would probably buy even more food. One product to watch is soyabeans. https://www.economist.com/china/2023/07/27/could-economic-indicators-signal-chinas-intent-to-go-to-war China is buying soybeans like theres no tomorrow 🌎🌱 Imports just surged and when the worlds largest buyer moves ag markets feel it. If you care about soybeans biofuels or global trade you need to read this 👇 https://t.co/AwsLVu4pvM @MacroView_Jake @GilbertieSal"
X Link 2026-02-12T14:46Z 17.3K followers, [----] engagements

"Incorrect take. Money = Power Power Rules https://www.fsb.org/about/rcgs/ Interesting post by @robin_j_brooks. More than Russia it's about the ethos of Europe in the new world order. The Euro was built as a peacetime currency for a rules-based world. We don't live there anymore. In today's Capital Wars a relevant currency needs a backing: -The Dollar https://www.fsb.org/about/rcgs/ Interesting post by @robin_j_brooks. More than Russia it's about the ethos of Europe in the new world order. The Euro was built as a peacetime currency for a rules-based world. We don't live there anymore. In"
X Link 2026-02-12T14:58Z 17.3K followers, [---] engagements

"🤣 https://t.co/hzNTk9kqk5 https://t.co/hzNTk9kqk5"
X Link 2026-02-12T15:10Z 17.3K followers, [----] engagements

"RT @Ole_S_Hansen: In #silver those pinning their 'hopes' on another squeeze are currently focusing on COMEX registered stocks versus open"
X Link 2026-02-12T15:15Z 17.3K followers, [--] engagements

"Auspice Capital: Agflation Acceleration Coming Soon #CommoditySupercycle https://www.auspicecapital.com/alt-invest/2023/7/5/agflation-acceleration-coming-soon https://www.auspicecapital.com/alt-invest/2023/7/5/agflation-acceleration-coming-soon"
X Link 2023-09-10T04:31Z 17.3K followers, [----] engagements

"Some ideas for #energy investors below - now do #metals What are your favourites for the year ahead #copper #gold #silver #tungsten What is your favorite oil and gas related stock for [----] What is your favorite oil and gas related stock for 2026"
X Link 2025-12-26T13:54Z 17.3K followers, 16.4K engagements

"Picked up some $OXY and $CF today. Hesitant to take a bite of Canadian energy right now but looking at Lotus Creek Exploration $LTC.v Share count 40M Don Gray of $PEY.TO involved. Hearing positives about CEO Kevin Johnson. Interest piqued. Thoughts"
X Link 2026-01-30T03:06Z 17.3K followers, 10.2K engagements

"Recommended read for Canadian energy investors: One Project One Review One Window Projects of National Interest Major Federal Project Office. I really don't see how they could make it any clearer. https://liberal.ca/wp-content/uploads/sites/292/2025/04/Mark-Carneys-Liberals-to-make-Canada-the-worlds-leading-energy-superpower.pdf https://liberal.ca/wp-content/uploads/sites/292/2025/04/Mark-Carneys-Liberals-to-make-Canada-the-worlds-leading-energy-superpower.pdf"
X Link 2026-02-03T04:04Z 17.3K followers, [----] engagements

"This is an interesting and long dormant story. Might be waking up at last. $BCU.v"
X Link 2026-02-04T02:46Z 17.3K followers, [----] engagements

"My sincere condolences to the families of the miners and to everyone at Vizsla Silver. This is a devastating and heartbreaking loss. https://www.cbc.ca/news/world/workers-identified-mexico-9.7080397 https://www.cbc.ca/news/world/workers-identified-mexico-9.7080397"
X Link 2026-02-09T14:59Z 17.3K followers, [----] engagements

"To the giant a-holes out there accusing Mike Konnert of selling as though he had knowledge something horrific like this would happen - GFY.Maybe learn how to look beyond p1 of SEDI. https://www.theglobeandmail.com/business/article-kidnap-vizsla-silver-miners-mexico/ https://www.theglobeandmail.com/business/article-kidnap-vizsla-silver-miners-mexico/"
X Link 2026-02-11T03:53Z 17.3K followers, [----] engagements

"@Nick_duCat Sorry to hear that Nick I hope you feel better soon 🙏"
X Link 2026-02-12T17:41Z 17.3K followers, [---] engagements

"Agnico Eagle's Ammar Al-Joundi's comments suggest a more proactive approach to doing deals from a CEO who has traditionally been reserved on transactions. "willing to move.when we see an opportunity on the M&A side" https://www.mining.com/web/world-no-2-gold-miner-is-willing-to-move-on-ma-ceo-says/ https://www.mining.com/web/world-no-2-gold-miner-is-willing-to-move-on-ma-ceo-says/"
X Link 2026-02-14T01:47Z 17.3K followers, [----] engagements

"SMM China Metals: #Silvers underlying supply-demand fundamentals remain supportive. The silver market is expected to remain in deficit (total supply less demand) for a sixth consecutive year in [----]. https://news.metal.com/newscontent/103765238-Global-Silver-Investment-to-Remain-Strong-in-2026-Against-the-Backdrop-of-a-Sixth-Consecutive-Annual-Market-Deficit https://news.metal.com/newscontent/103765238-Global-Silver-Investment-to-Remain-Strong-in-2026-Against-the-Backdrop-of-a-Sixth-Consecutive-Annual-Market-Deficit"
X Link 2026-02-14T01:59Z 17.3K followers, [---] engagements

"SMM China Metals (Feb 2) Surging European #tungsten prices driven by low inventories and panic buying highlighted a severe supply-demand imbalance https://news.metal.com/newscontent/103751261-SMM-Analysis-Tungsten-Inventory-Depletion-in-Europe-Triggers-Panic-Buying-Accelerating-Global-Price-Uptrend https://news.metal.com/newscontent/103751261-SMM-Analysis-Tungsten-Inventory-Depletion-in-Europe-Triggers-Panic-Buying-Accelerating-Global-Price-Uptrend"
X Link 2026-02-14T02:00Z 17.3K followers, [----] engagements

"Govt of Canada on Immigration goals establish a 12% target for Francophone immigration outside of Quebec by [----] to promote the vitality of Francophone communities https://www.canada.ca/en/immigration-refugees-citizenship/corporate/transparency/consultations/2025-consultations-immigration-levels.html https://www.canada.ca/en/immigration-refugees-citizenship/corporate/transparency/consultations/2025-consultations-immigration-levels.html"
X Link 2026-02-14T06:48Z 17.3K followers, [---] engagements

"'This reductionist view of the human condition is a poor foundation for ethical financial institutions needed to support long-term prosperity.' (Please read the speeches 🙏) https://www.bis.org/review/r130226c.pdf https://www.bis.org/review/r130226c.pdf"
X Link 2026-02-02T20:52Z 17.3K followers, [---] engagements

"Was hoping this was AI but no. And I dont think AI could have come up with such a nails on a chalkboard voice either https://patrioticmillionaires.ca/about-us They want a global asset registry https://t.co/aUBz3H0j35 https://patrioticmillionaires.ca/about-us They want a global asset registry https://t.co/aUBz3H0j35"
X Link 2026-02-14T07:18Z 17.3K followers, [----] engagements

"@jameskwantes Ah but it's not Dalio you should be reading - he doesn't make the policies that are about to rock your world. Give it [--] months then let's chat :)"
X Link 2026-02-16T04:29Z 17.3K followers, [---] engagements

"Nothing shows you who your true friends are more than in a time of crisis. There are some really amazing people in this world and I can tell you they exist on Twitter 💕"
X Link 2023-10-05T21:37Z 17.3K followers, 19.3K engagements

"Qalid is a twat. If she isnt under investigation yet she should be soon 🤨 https://www.ourcommons.ca/documentviewer/en/44-1/PACP/meeting-144/evidence #BREAKING: Trudeau Liberal MP Iqra Qalid takes to X to peddle a baseless conspiracy theory alleging that Pierre Poilievre's recent interview with Jordan Peterson was paid for by the government of Russia. https://t.co/PumW3pe6ky https://www.ourcommons.ca/documentviewer/en/44-1/PACP/meeting-144/evidence #BREAKING: Trudeau Liberal MP Iqra Qalid takes to X to peddle a baseless conspiracy theory alleging that Pierre Poilievre's recent interview with"
X Link 2025-01-03T21:42Z 17.3K followers, [----] engagements

"The president of the Caisse de dpt et placement du Qubec Sabia spent a weekend at the expense of the Desmarais at Sagard a huge private property with 'many buildings a private golf course and especially a huge house reminiscent of the Palace of Versailles in France.'"
X Link 2025-01-04T22:59Z 17.3K followers, 13.6K engagements

"BTW re Bell privatization: On November [--] [----] BCE announced thatKPMGhad informed BCE that it would not be able to issue a statement on the solvency of the company after itsprivatization one of the required conditions of the buyout. As a result the purchase was cancelled"
X Link 2025-01-04T23:01Z 17.3K followers, 13K engagements

"So at what point do Canadians realize the PM is a CCP simp 🤔 Really people You would rather be a colony of Chinas than a friend of Americas Because thats where we are at"
X Link 2025-10-26T13:57Z 17.3K followers, [----] engagements

"Agnico Eagle has launched a new subsidiary Avenir Minerals Limited to manage and advance nearly $80 million in early-stage critical minerals investments with a primary focus on Canada. https://www.mining.com/agnico-eagle-launches-130m-avenir-unit-for-critical-minerals/ https://www.mining.com/agnico-eagle-launches-130m-avenir-unit-for-critical-minerals/"
X Link 2025-10-31T19:43Z 17.3K followers, 18.6K engagements

"Some of our best past calls in commodities came from avoiding bad management teams and crowded narratives. The public record is there. I'll hope you'll consider signing up for our newsletter to help you navigate the high-risk junior sector. /1 of [--] https://sandpipertradingcorporation.com https://sandpipertradingcorporation.com"
X Link 2025-12-17T00:40Z 17.3K followers, 12.2K engagements

"Just curious - for the Canadians that are all "rah-rah let's partner with China - elbows up" - why do you suppose CSIS's public report on risks to Canadians covers the PRC repeatedly and never the USA https://www.canada.ca/en/security-intelligence-service/corporate/publications/csis-public-report-2023/mission-focused.html https://www.canada.ca/en/security-intelligence-service/corporate/publications/csis-public-report-2023/mission-focused.html"
X Link 2026-02-14T22:55Z 17.3K followers, [----] engagements

"THIS 💯💯💯 PLEASE MY FELLOW CANADIANS - PAY ATTENTION 🙏 It is far from just Indigenous $$$ please care where its going - because I guarantee you its not where you think. When we go broke it will be too late. 🚨Canadas Corruption runs deep. Our Government spent $300 Billion over [--] years on indigenous programs and nothing to show for. You get it yet https://t.co/MidVT5Rn89 🚨Canadas Corruption runs deep. Our Government spent $300 Billion over [--] years on indigenous programs and nothing to show for. You get it yet https://t.co/MidVT5Rn89"
X Link 2026-02-15T16:48Z 17.3K followers, [----] engagements

"The hypocrisy did not end with junior. #values GOLDSTEIN: The massive carbon footprint of Trudeaus post-political life If you want to convince the world to live a low-carbon lifestyle 'rules for thee but not for me' is the wrong place to start https://t.co/DrBocAOHIN GOLDSTEIN: The massive carbon footprint of Trudeaus post-political life If you want to convince the world to live a low-carbon lifestyle 'rules for thee but not for me' is the wrong place to start https://t.co/DrBocAOHIN"
X Link 2026-02-15T17:02Z 17.3K followers, [----] engagements

"Govt: "Canada was one of the first contributors.Most of this funding is through its $5.3 billion climate finance commitment" Also Govt: "In the coming years access to basic necessities like water food energy shelter and financial security and employment might become out of reach for many." https://www.canada.ca/en/services/environment/weather/climatechange/canada-international-action/un-climate-change-conference/cop28-summit/summary-outcomes.html"
X Link 2026-02-15T22:22Z 17.3K followers, [----] engagements

""This has the potential to be applied at the global level too. reparations for colonialism slavery and climate loss and damage (noting there is a new UN fund)." https://www.wider.unu.edu/publication/great-gatsby-curve-and-global-south https://www.wider.unu.edu/publication/great-gatsby-curve-and-global-south"
X Link 2026-02-15T22:22Z 17.3K followers, [---] engagements

"Incorrect take. Kissinger was the Global Architect of the chaos in front of us today. He did say war with China was inevitable so I guess he will be on the right side of history about one thing anyway. I loved @SecRubio's speech & agree he is doing very well. But #Kissinger was the first to do both. As for only Secretary of State the list of who was a better one than Kissinger is very small too. I don't know if there is anyone higher than Kissinger as SOS besides maybe I loved @SecRubio's speech & agree he is doing very well. But #Kissinger was the first to do both. As for only Secretary of"
X Link 2026-02-15T23:40Z 17.3K followers, [----] engagements

"https://www.bbc.com/news/world-asia-china-67563597 https://www.bbc.com/news/world-asia-china-67563597"
X Link 2026-02-15T23:40Z 17.3K followers, [---] engagements

"This is a tad concerning 🤔 Russia and China getting ready to project military and economic power in the Arctic. https://thedefensepost.com/2026/02/15/uk-aircraft-carrier-arctic/ https://thedefensepost.com/2026/02/15/uk-aircraft-carrier-arctic/"
X Link 2026-02-16T01:59Z 17.3K followers, [----] engagements

"If you're a fan of Vivian Krause's work - as I am - this is a fun read. Rockefeller pre-budget recommendations for the govt: - Indigenous language programming $3.5 billion annually - $300M per year towards Indigenous Guardian programs /1 of [--] https://www.ourcommons.ca/Content/Committee/441/FINA/Brief/BR13229737/br-external/MakeWayFoundation-e.pdf#::text=This%20funding%20can%20help%20Canadafederal%2C%20provincial%2C%20territorial%20and%20Indigenous"
X Link 2026-02-16T03:25Z 17.3K followers, [----] engagements

"- $250 million towards the Harvester Support Grant and Community Food Programs Fund over five years (because Colonial policies disrupted traditional livelihoods and severed ties to the land leading to poverty social problems and a loss of self-sufficiency)"
X Link 2026-02-16T03:25Z 17.3K followers, [---] engagements

"- $25 million per year to monitor and provide additional guidance for the charitable sector Phew it's a good thing charities like Makeway are eligible for all those government grants. The Rockefellers need all the help they can get right taxpayers https://www.canada.ca/en/services/environment/weather/climatechange/climate-plan/reduce-emissions/reducing-reliance-diesel/wah-ila-toos-applicant-guide.html#4.1 https://www.canada.ca/en/services/environment/weather/climatechange/climate-plan/reduce-emissions/reducing-reliance-diesel/wah-ila-toos-applicant-guide.html#4.1"
X Link 2026-02-16T03:25Z 17.3K followers, [---] engagements

"And some think history doesn't even rhyme - SMH. The Ottawa Citizen would like a word.What's old can be new again King had bowed at the altar of John D. Rockefeller himself the king of the robber barons. https://ottawacitizen.com/opinion/mark-carney-mackenzie-king If you're a fan of Vivian Krause's work - as I am - this is a fun read. Rockefeller pre-budget recommendations for the govt: - Indigenous language programming $3.5 billion annually - $300M per year towards Indigenous Guardian programs /1 of [--] https://t.co/qwV8hf43za https://t.co/LXaetPbr4r"
X Link 2026-02-16T03:29Z 17.3K followers, [---] engagements

"Any thoughts on Canadas largest union with [------] members across the country calling Premier Smith 'a snake a traitor and a sell out' a year ago I guess unions aren't about being professional so no biggie 🤷♀ https://cupe.ca/cupe-calls-out-traitors-danielle-smith-and-kevin-oleary https://cupe.ca/cupe-calls-out-traitors-danielle-smith-and-kevin-oleary"
X Link 2026-02-16T03:33Z 17.3K followers, [----] engagements

"They can tax that way they can take your money Pfft what does Ray Dalio know No one cares Ray save your breath - right @jameskwantes #OrangeManBad 🚨 RAY DALIO SOUNDS THE ALARM ON CENTRAL BANK DIGITAL CURRENCIES. Billionaire hedge fund manager Ray Dalio tells Tucker Carlson central bank digital currencies are coming: "There will be no privacy. all transactions will be known. and if you're politically disfavored you https://t.co/gF9YSjjnze 🚨 RAY DALIO SOUNDS THE ALARM ON CENTRAL BANK DIGITAL CURRENCIES. Billionaire hedge fund manager Ray Dalio tells Tucker Carlson central bank digital"
X Link 2026-02-16T03:41Z 17.3K followers, [----] engagements

"Know who is a fan of CBDC's and how they could 'dampen the domineering influence of the US dollar on global trade' This guy "They can tax that way they can take your money" Informative [----] Carney speech: https://www.bankofengland.co.uk/-/media/boe/files/speech/2019/the-growing-challenges-for-monetary-policy-speech-by-mark-carney.pdf They can tax that way they can take your money Pfft what does Ray Dalio know No one cares Ray save your breath - right @jameskwantes #OrangeManBad"
X Link 2026-02-16T03:47Z 17.3K followers, [----] engagements

"2019 Carney: "The dollars influence on global financial conditions could similarly decline if a financial architecture developed around the new SHC (CBDC) and it displaced the dollars dominance in credit markets." #ElbowsUp Know who is a fan of CBDC's and how they could 'dampen the domineering influence of the US dollar on global trade' This guy "They can tax that way they can take your money" Informative [----] Carney speech: https://t.co/PX86V0gd6U https://t.co/jQ16vW9JGj Know who is a fan of CBDC's and how they could 'dampen the domineering influence of the US dollar on global trade' This"
X Link 2026-02-16T03:50Z 17.3K followers, [----] engagements

"Excuse me🤔 Carney 2019: "transition to a new hegemonic reserve currency like the Renminbi" https://www.bankofengland.co.uk/-/media/boe/files/speech/2019/the-growing-challenges-for-monetary-policy-speech-by-mark-carney.pdf [----] Carney: "The dollars influence on global financial conditions could similarly decline if a financial architecture developed around the new SHC (CBDC) and it displaced the dollars dominance in credit markets." #ElbowsUp https://www.bankofengland.co.uk/-/media/boe/files/speech/2019/the-growing-challenges-for-monetary-policy-speech-by-mark-carney.pdf [----] Carney: "The"
X Link 2026-02-16T03:52Z 17.3K followers, [----] engagements

"'Widespread use of the SHC in international trade and finance would imply that the currencies that compose its basket could gradually be seen as reliable reserve assets encouraging EMEs to diversify their holdings of safe assets away from the dollar.' https://www.fsb.org/about/rcgs/ https://www.fsb.org/about/rcgs/"
X Link 2026-02-16T03:56Z 17.3K followers, [----] engagements

"Fun fact: Mark Carney served as the Chair of the Financial Stability Board (FSB) from [----] to [----]. https://www.fsb.org/about/rcgs/ 'Widespread use of the SHC in international trade and finance would imply that the currencies that compose its basket could gradually be seen as reliable reserve assets encouraging EMEs to diversify their holdings of safe assets away from the dollar.' https://t.co/QbR5YSz1Fv https://t.co/biTF4NNy2k https://www.fsb.org/about/rcgs/ 'Widespread use of the SHC in international trade and finance would imply that the currencies that compose its basket could"
X Link 2026-02-16T03:57Z 17.3K followers, [---] engagements

"I'm really not sure if I was giving a speech on monetary policy and economic uncertainty if THESE are the incidents I would refer to you 🤔 https://www.bankofengland.co.uk/-/media/boe/files/speech/2019/the-growing-challenges-for-monetary-policy-speech-by-mark-carney.pdf https://www.bankofengland.co.uk/-/media/boe/files/speech/2019/the-growing-challenges-for-monetary-policy-speech-by-mark-carney.pdf"
X Link 2026-02-16T04:00Z 17.3K followers, [---] engagements

"RBC on Project Vault: "Notably Canada wasnt among the signatories" of Washingtons inaugural Critical Minerals Ministerial https://www.rbc.com/en/thought-leadership/the-trade-zone/will-canada-get-keys-to-the-vault/ https://www.rbc.com/en/thought-leadership/the-trade-zone/will-canada-get-keys-to-the-vault/"
X Link 2026-02-16T19:15Z 17.3K followers, [---] engagements

Limited data mode. Full metrics available with subscription: lunarcrush.com/pricing